SCOPe 2.08: Domain d5bzdd1: 5bzd D:6-216

Lineage for d5bzdd1 (5bzd D:6-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5bzdd1: 5bzd D:6-216 [409841]
   Other proteins in same PDB: d5bzda1, d5bzda2, d5bzdb2, d5bzdc1, d5bzdc2, d5bzdd2
   automated match to d6shgh_
   complexed with gol

Details for d5bzdd1

PDB Entry: 5bzd, 2.7 Å

PDB Description: crystal structure of pcdn-27a, an antibody from the pcdn family of hiv-1 antibodies

PDB Compounds: (D:) 5G8 HIV Antibody heavy chain

SCOPe Domain Sequences for d5bzdd1:

Sequence, based on SEQRES records:

>d5bzdd1 b.1.1.0 (D:6-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwgagllkpsetlsltcavygesfsafswswirqppgkglewigeidhtgsanynpslks
rismsvdtsmnqfslellsmtvadtavyycarggrkvyhaywsgyvnncfdpwgqgtlvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

Sequence, based on observed residues (ATOM records):

>d5bzdd1 b.1.1.0 (D:6-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwgagllkpsetlsltcavygesfsafswswirqppgkglewigeidhtgsanynpslks
rismsvdtsmnqfslellsmtvadtavyycarggrkvyhaywsgyvnncfdpwgqgtlvt
vssastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

Timeline for d5bzdd1:

• d5bzdd1 is new in SCOPe 2.08-stable