Lineage for d5bzda1 (5bzd A:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (193 PDB entries)
  8. 2347529Domain d5bzda1: 5bzd A:1-106 [317720]
    Other proteins in same PDB: d5bzda2, d5bzdc2
    automated match to d1dn0a1
    complexed with gol

Details for d5bzda1

PDB Entry: 5bzd (more details), 2.7 Å

PDB Description: crystal structure of pcdn-27a, an antibody from the pcdn family of hiv-1 antibodies
PDB Compounds: (A:) 5G8 HIV Antibody light chain

SCOPe Domain Sequences for d5bzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bzda1 b.1.1.1 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslsageratlscrasqsvsarnlawyqqkpgqaprlllygvsirntgvp
drfsgsgsgtdftltisrlepedfavyycqqygdsptfgqgtkvei

SCOPe Domain Coordinates for d5bzda1:

Click to download the PDB-style file with coordinates for d5bzda1.
(The format of our PDB-style files is described here.)

Timeline for d5bzda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bzda2