SCOPe 2.06: Domain d4zvvd1: 4zvv D:1-159

Lineage for d4zvvd1 (4zvv D:1-159)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (16 PDB entries)

8. Domain d4zvvd1: 4zvv D:1-159 [317596]
   Other proteins in same PDB: d4zvva2, d4zvvb2, d4zvvc2, d4zvvd2
   automated match to d4jnka1
   complexed with gn0, nad, so4

Details for d4zvvd1

PDB Entry: 4zvv, 2.2 Å

PDB Description: lactate dehydrogenase a in complex with a trisubstituted piperidine-2, 4-dione inhibitor gne-140

PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4zvvd1:

Sequence; same for both SEQRES and ATOM records:

>d4zvvd1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4zvvd1:

• d4zvvd1 is new in SCOPe 2.06-stable
  
• d4zvvd1 appears in SCOPe 2.07
  
• d4zvvd1 appears in the current release, SCOPe 2.08