Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52473] (3 PDB entries) |
Domain d1efva2: 1efv A:208-331 [31728] Other proteins in same PDB: d1efva1, d1efvb_ complexed with amp, fad |
PDB Entry: 1efv (more details), 2.1 Å
SCOPe Domain Sequences for d1efva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} drpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtg kivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemt eilk
Timeline for d1efva2: