| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
| Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52473] (3 PDB entries) |
| Domain d1efva2: 1efv A:208-331 [31728] Other proteins in same PDB: d1efva1, d1efvb_ complexed with amp, fad |
| PDB Entry: 1efv (more details) PDB Description: three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution
PDB Compounds: (A:) electron transfer flavoproteinSCOP Domain Sequences for d1efva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
drpeltgakvvvsggrglksgenfkllydladqlhaavgasraavdagfvpndmqvgqtg
kivapelyiavgisgaiqhlagmkdsktivainkdpeapifqvadygivadlfkvvpemt
eilk
SCOP Domain Coordinates for d1efva2:
Click to download the PDB-style file with coordinates for d1efva2. (The format of our PDB-style files is described here.)
Timeline for d1efva2:
d1efva2 appears in SCOP 1.73 | d1efva2 (click for larger image) d1efva2 in context of chain Domains from same chain: d1efva1 d1efva2 in context of PDB Domains from other chains: d1efvb_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |