Lineage for d5jhva1 (5jhv A:1-196)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136662Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2136663Protein PA N-terminal domain [254375] (5 species)
  7. 2136686Species Influenza A virus [TaxId:93838] [254808] (31 PDB entries)
  8. 2136746Domain d5jhva1: 5jhv A:1-196 [317271]
    Other proteins in same PDB: d5jhva2, d5jhvb2
    automated match to d4e5ed_
    complexed with mn

Details for d5jhva1

PDB Entry: 5jhv (more details), 2.75 Å

PDB Description: apo form of influenza strain h1n1 polymerase acidic subunit n-terminal region crystallized with polyethylene glycol 8000
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5jhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhva1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaektmkeygedlkietnkfaaicthlevcfmysdaskhrfeiie
grdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiyylekankiks
ekthihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqser

SCOPe Domain Coordinates for d5jhva1:

Click to download the PDB-style file with coordinates for d5jhva1.
(The format of our PDB-style files is described here.)

Timeline for d5jhva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jhva2