Lineage for d5f5wa_ (5f5w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967844Protein automated matches [193659] (8 species)
    not a true protein
  7. 2967845Species Aquifex aeolicus [TaxId:224324] [317216] (1 PDB entry)
  8. 2967846Domain d5f5wa_: 5f5w A: [317269]
    automated match to d1j5wa_
    protein/RNA complex; complexed with g5a

Details for d5f5wa_

PDB Entry: 5f5w (more details), 2.81 Å

PDB Description: crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
PDB Compounds: (A:) Glycine--tRNA ligase alpha subunit

SCOPe Domain Sequences for d5f5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f5wa_ d.104.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
myfqdiimtlhkfwaekgcliwqpydvevgagtmnpatflkvlgkkpwnvayvepsrrpq
dgrygenpnrlqhyyqfqvilkpaprnpqeiyleslerlginplehdirfveddwesptl
gawglgwevwldgmeitqftyfqqaggldldeisveitygleriamyiqdkdsvfdiewk
egitygeifkrsewewskynfeladtdmlfqvyemfekeskrmveeglifpaydyllkcs
hvfnildargaisvqeraryirrmnnlareiaklylqvfenvg

SCOPe Domain Coordinates for d5f5wa_:

Click to download the PDB-style file with coordinates for d5f5wa_.
(The format of our PDB-style files is described here.)

Timeline for d5f5wa_: