Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein automated matches [193659] (8 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [317216] (1 PDB entry) |
Domain d5f5wa_: 5f5w A: [317269] automated match to d1j5wa_ protein/RNA complex; complexed with g5a |
PDB Entry: 5f5w (more details), 2.81 Å
SCOPe Domain Sequences for d5f5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f5wa_ d.104.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} myfqdiimtlhkfwaekgcliwqpydvevgagtmnpatflkvlgkkpwnvayvepsrrpq dgrygenpnrlqhyyqfqvilkpaprnpqeiyleslerlginplehdirfveddwesptl gawglgwevwldgmeitqftyfqqaggldldeisveitygleriamyiqdkdsvfdiewk egitygeifkrsewewskynfeladtdmlfqvyemfekeskrmveeglifpaydyllkcs hvfnildargaisvqeraryirrmnnlareiaklylqvfenvg
Timeline for d5f5wa_:
View in 3D Domains from other chains: (mouse over for more information) d5f5wb_, d5f5wc_, d5f5wd_, d5f5we_ |