| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) ![]() |
| Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins) |
| Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species) |
| Species Escherichia coli [TaxId:562] [52451] (9 PDB entries) |
| Domain d1jdbh4: 1jdb H:556-676 [31710] Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |
PDB Entry: 1jdb (more details), 2.1 Å
SCOP Domain Sequences for d1jdbh4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdbh4 c.30.1.1 (H:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
tdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdrl
yfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedre
r
Timeline for d1jdbh4:
View in 3DDomains from other chains: (mouse over for more information) d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |