Lineage for d1jdbh4 (1jdb H:556-676)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22644Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 22645Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 22646Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 22655Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)
  7. 22656Species Escherichia coli [TaxId:562] [52451] (7 PDB entries)
  8. 22710Domain d1jdbh4: 1jdb H:556-676 [31710]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2

Details for d1jdbh4

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbh4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbh4 c.30.1.1 (H:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
tdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdrl
yfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedre
r

SCOP Domain Coordinates for d1jdbh4:

Click to download the PDB-style file with coordinates for d1jdbh4.
(The format of our PDB-style files is described here.)

Timeline for d1jdbh4: