SCOPe 2.06: Domain d4z8db1: 4z8d B:1-174

Lineage for d4z8db1 (4z8d B:1-174)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (4 species)

7. Species Escherichia coli [TaxId:83334] [317080] (1 PDB entry)

8. Domain d4z8db1: 4z8d B:1-174 [317081]
   automated match to d1hnja1
   complexed with 4lb, so4; mutant

Details for d4z8db1

PDB Entry: 4z8d, 2 Å

PDB Description: antibacterial fabh inhibitors with validated mode of action in haemophilus influenzae by in vitro resistance mutation mapping

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4z8db1:

Sequence; same for both SEQRES and ATOM records:

>d4z8db1 c.95.1.2 (B:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 83334]}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

Timeline for d4z8db1:

• d4z8db1 is new in SCOPe 2.06-stable
  
• d4z8db1 appears in SCOPe 2.07
  
• d4z8db1 appears in the current release, SCOPe 2.08