PDB entry 4z8d

View 4z8d on RCSB PDB site
Description: Antibacterial FabH Inhibitors with Validated Mode of Action in Haemophilus Influenzae by in vitro resistance mutation mapping
Class: Transferase/Transferase inhibitor
Keywords: Beta-ketoacyl-(acyl-carrier-protein) synthase III, carbamate, structure based drug design, fatty acid biosynthesis, Transferase-Transferase inhibitor complex
Deposited on 2015-04-08, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: fabH, Z1730, ECs1469
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z8da1, d4z8da2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: fabH, Z1730, ECs1469
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z8db1, d4z8db2
  • Heterogens: 4LB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z8dA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z8dB (B:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf