Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (15 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [317019] (1 PDB entry) |
Domain d5jd3b1: 5jd3 B:1-217 [317026] Other proteins in same PDB: d5jd3a2, d5jd3b2, d5jd3c2, d5jd3d2, d5jd3e2, d5jd3f2, d5jd3h2 automated match to d4jhla_ complexed with cl, peg, so4 |
PDB Entry: 5jd3 (more details), 2.3 Å
SCOPe Domain Sequences for d5jd3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jd3b1 c.23.10.0 (B:1-217) automated matches {Uncultured bacterium [TaxId: 77133]} myfaagsklviigdsitdagrdkgiggeglfnahgsgyvallnahlfarfperrlrlvnq gnsgntvrdlaarwqndvfglkpdyvammigindvwrqfdlplmtdrhvcpeeyektlde lvartaptvkgmilltpyfiepnredamrarmdvygdlmrrvaerhgcllvdvqgafdry lqhyhpaqlawdrihpnlaghqvianaflaatgclns
Timeline for d5jd3b1: