Lineage for d1c30g4 (1c30 G:556-676)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178746Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 178747Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 178748Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 178757Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)
  7. 178758Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)
  8. 178782Domain d1c30g4: 1c30 G:556-676 [31672]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c2, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e2, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g2, d1c30g5, d1c30g6, d1c30h1, d1c30h2

Details for d1c30g4

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30g4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30g4 c.30.1.1 (G:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1c30g4:

Click to download the PDB-style file with coordinates for d1c30g4.
(The format of our PDB-style files is described here.)

Timeline for d1c30g4: