Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) |
Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein) |
Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species) |
Species Escherichia coli [TaxId:562] [52338] (9 PDB entries) |
Domain d1c30e2: 1c30 E:936-1073 [31485] Other proteins in same PDB: d1c30a1, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2 |
PDB Entry: 1c30 (more details), 2 Å
SCOP Domain Sequences for d1c30e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c30e2 c.24.1.1 (E:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli} nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln adatekvisvqemhaqik
Timeline for d1c30e2:
View in 3D Domains from other chains: (mouse over for more information) d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30f1, d1c30f2, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1, d1c30h2 |