Lineage for d1c30e3 (1c30 E:1-127)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 985731Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 985732Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 985733Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 985760Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 985761Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 985774Domain d1c30e3: 1c30 E:1-127 [31669]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a5, d1c30a6, d1c30b1, d1c30b2, d1c30c1, d1c30c2, d1c30c5, d1c30c6, d1c30d1, d1c30d2, d1c30e1, d1c30e2, d1c30e5, d1c30e6, d1c30f1, d1c30f2, d1c30g1, d1c30g2, d1c30g5, d1c30g6, d1c30h1, d1c30h2
    complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30e3

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s
PDB Compounds: (E:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c30e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30e3 c.30.1.1 (E:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

SCOPe Domain Coordinates for d1c30e3:

Click to download the PDB-style file with coordinates for d1c30e3.
(The format of our PDB-style files is described here.)

Timeline for d1c30e3: