SCOPe 2.01: Domain d1c30d1: 1c30 D:2-152

Lineage for d1c30d1 (1c30 D:2-152)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family)

5. Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)

6. Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)

7. Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
   Uniprot P00907

8. Domain d1c30d1: 1c30 D:2-152 [30737]
   Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b2, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d2, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f2, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h2
   complexed with adp, cl, k, mn, net, orn, po4; mutant

Details for d1c30d1

PDB Entry: 1c30, 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

PDB Compounds: (D:) carbamoyl phosphate synthetase: small subunit

SCOPe Domain Sequences for d1c30d1:

Sequence; same for both SEQRES and ATOM records:

>d1c30d1 c.8.3.1 (D:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

Timeline for d1c30d1:

• d1c30d1 first appeared (with stable ids) in SCOP 1.55
  
• d1c30d1 appears in SCOP 1.75
  
• d1c30d1 appears in SCOPe 2.02
  
• d1c30d1 appears in the current release, SCOPe 2.08