|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest | 
|  | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)  | 
|  | Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 | 
|  | Protein PA N-terminal domain [254375] (7 species) | 
|  | Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries) | 
|  | Domain d5czna1: 5czn A:1-195 [316562] Other proteins in same PDB: d5czna2 automated match to d5dbsa_ complexed with mn, so4; mutant | 
PDB Entry: 5czn (more details), 1.98 Å
SCOPe Domain Sequences for d5czna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5czna1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfidigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse
Timeline for d5czna1: