Lineage for d5dbsa_ (5dbs A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136662Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2136663Protein PA N-terminal domain [254375] (5 species)
  7. 2136686Species Influenza A virus [TaxId:93838] [254808] (31 PDB entries)
  8. 2136756Domain d5dbsa_: 5dbs A: [313358]
    automated match to d4e5ed_

Details for d5dbsa_

PDB Entry: 5dbs (more details)

PDB Description: 2009 h1n1 pa endonuclease mutant e119d in complex with dtmp
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5dbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dbsa_ c.52.1.34 (A:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
gshmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrf
eiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfidigvtrrevhiyylekan
kiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse

SCOPe Domain Coordinates for d5dbsa_:

Click to download the PDB-style file with coordinates for d5dbsa_.
(The format of our PDB-style files is described here.)

Timeline for d5dbsa_: