| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) ![]() |
| Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
| Protein PA N-terminal domain [254375] (5 species) |
| Species Influenza A virus [TaxId:93838] [254808] (31 PDB entries) |
| Domain d5dbsa_: 5dbs A: [313358] automated match to d4e5ed_ |
PDB Entry: 5dbs (more details)
SCOPe Domain Sequences for d5dbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dbsa_ c.52.1.34 (A:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
gshmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrf
eiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfidigvtrrevhiyylekan
kiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse
Timeline for d5dbsa_: