SCOPe 2.06: Domain d5ccya1: 5ccy A:1-196

Lineage for d5ccya1 (5ccy A:1-196)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza A virus [TaxId:93838] [254808] (31 PDB entries)

8. Domain d5ccya1: 5ccy A:1-196 [316520]
   Other proteins in same PDB: d5ccya2
   automated match to d4e5ed_
   complexed with mn, tmp

Details for d5ccya1

PDB Entry: 5ccy, 2.1 Å

PDB Description: 2009 h1n1 pa endonuclease in complex with dtmp

PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5ccya1:

Sequence; same for both SEQRES and ATOM records:

>d5ccya1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser

Timeline for d5ccya1:

• d5ccya1 is new in SCOPe 2.06-stable
  
• d5ccya1 appears in SCOPe 2.07
  
• d5ccya1 appears in the current release, SCOPe 2.08