Lineage for d5a5fa2 (5a5f A:94-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904995Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2904996Family c.72.2.1: MurCDEF [53624] (5 proteins)
    automatically mapped to Pfam PF08245
  6. 2905026Protein automated matches [254549] (3 species)
    not a true protein
  7. 2905039Species Escherichia coli [TaxId:83333] [316489] (1 PDB entry)
  8. 2905040Domain d5a5fa2: 5a5f A:94-297 [316490]
    Other proteins in same PDB: d5a5fa1, d5a5fa3, d5a5fa4
    automated match to d4uaga3
    complexed with adp, mli, uma

Details for d5a5fa2

PDB Entry: 5a5f (more details), 1.9 Å

PDB Description: crystal structure of murd ligase from escherichia coli in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d5a5fa2:

Sequence, based on SEQRES records: (download)

>d5a5fa2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 83333]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d5a5fa2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 83333]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpircvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnalaalal
adaaglprasslkalttft

SCOPe Domain Coordinates for d5a5fa2:

Click to download the PDB-style file with coordinates for d5a5fa2.
(The format of our PDB-style files is described here.)

Timeline for d5a5fa2: