Lineage for d5a5fa3 (5a5f A:298-437)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890898Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2890899Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2890942Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 2890943Protein automated matches [254550] (5 species)
    not a true protein
  7. 2890956Species Escherichia coli [TaxId:83333] [316491] (1 PDB entry)
  8. 2890957Domain d5a5fa3: 5a5f A:298-437 [316492]
    Other proteins in same PDB: d5a5fa1, d5a5fa2, d5a5fa4
    automated match to d4uaga2
    complexed with adp, mli, uma

Details for d5a5fa3

PDB Entry: 5a5f (more details), 1.9 Å

PDB Description: crystal structure of murd ligase from escherichia coli in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d5a5fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5fa3 c.59.1.0 (A:298-437) automated matches {Escherichia coli [TaxId: 83333]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d5a5fa3:

Click to download the PDB-style file with coordinates for d5a5fa3.
(The format of our PDB-style files is described here.)

Timeline for d5a5fa3: