Lineage for d5a5fa1 (5a5f A:1-93)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110359Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2110360Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2110383Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2110384Protein automated matches [254548] (5 species)
    not a true protein
  7. 2110397Species Escherichia coli [TaxId:83333] [316487] (1 PDB entry)
  8. 2110398Domain d5a5fa1: 5a5f A:1-93 [316488]
    Other proteins in same PDB: d5a5fa2, d5a5fa3, d5a5fa4
    automated match to d4uaga1
    complexed with adp, mli, uma

Details for d5a5fa1

PDB Entry: 5a5f (more details), 1.9 Å

PDB Description: crystal structure of murd ligase from escherichia coli in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d5a5fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5fa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 83333]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d5a5fa1:

Click to download the PDB-style file with coordinates for d5a5fa1.
(The format of our PDB-style files is described here.)

Timeline for d5a5fa1: