| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
| Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
| Protein automated matches [254548] (7 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [316487] (1 PDB entry) |
| Domain d5a5fa1: 5a5f A:1-93 [316488] Other proteins in same PDB: d5a5fa2, d5a5fa3, d5a5fa4 automated match to d4uaga1 complexed with adp, mli, uma |
PDB Entry: 5a5f (more details), 1.9 Å
SCOPe Domain Sequences for d5a5fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a5fa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 83333]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg
Timeline for d5a5fa1: