Lineage for d1mjha_ (1mjh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591101Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 1591102Protein "Hypothetical" protein MJ0577 [52437] (1 species)
  7. 1591103Species Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)
  8. 1591104Domain d1mjha_: 1mjh A: [31639]
    structural genomics
    complexed with atp, mn

Details for d1mjha_

PDB Entry: 1mjh (more details), 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics
PDB Compounds: (A:) protein (ATP-binding domain of protein mj0577)

SCOPe Domain Sequences for d1mjha_:

Sequence, based on SEQRES records: (download)

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records): (download)

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikveefenelknklte
eaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeill
gsvtenvikksnkpvlvvkrkns

SCOPe Domain Coordinates for d1mjha_:

Click to download the PDB-style file with coordinates for d1mjha_.
(The format of our PDB-style files is described here.)

Timeline for d1mjha_: