![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
![]() | Protein 'Hypothetical' protein MJ0577 [52437] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry) |
![]() | Domain d1mjha_: 1mjh A: [31639] structural genomics complexed with atp, mn |
PDB Entry: 1mjh (more details), 1.7 Å
SCOPe Domain Sequences for d1mjha_:
Sequence, based on SEQRES records: (download)
>d1mjha_ c.26.2.4 (A:) 'Hypothetical' protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]} vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns
>d1mjha_ c.26.2.4 (A:) 'Hypothetical' protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]} vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikveefenelknklte eaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeill gsvtenvikksnkpvlvvkrkns
Timeline for d1mjha_: