Lineage for d1mjhb_ (1mjh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861467Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2861468Protein 'Hypothetical' protein MJ0577 [52437] (1 species)
  7. 2861469Species Methanococcus jannaschii [TaxId:2190] [52438] (1 PDB entry)
  8. 2861471Domain d1mjhb_: 1mjh B: [31640]
    structural genomics
    complexed with atp, mn

Details for d1mjhb_

PDB Entry: 1mjh (more details), 1.7 Å

PDB Description: structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics
PDB Compounds: (B:) protein (ATP-binding domain of protein mj0577)

SCOPe Domain Sequences for d1mjhb_:

Sequence, based on SEQRES records: (download)

>d1mjhb_ c.26.2.4 (B:) 'Hypothetical' protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvagl
nksveefenelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvd
iiimgshgktnlkeillgsvtenvikksnkpvlvvkrkns

Sequence, based on observed residues (ATOM records): (download)

>d1mjhb_ c.26.2.4 (B:) 'Hypothetical' protein MJ0577 {Methanococcus jannaschii [TaxId: 2190]}
vmykkilyptdfsetaeialkhvkafktlkaeevillhvidereiksveefenelknklt
eeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeil
lgsvtenvikksnkpvlvvkrkns

SCOPe Domain Coordinates for d1mjhb_:

Click to download the PDB-style file with coordinates for d1mjhb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjhb_: