Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
Protein automated matches [254721] (3 species) not a true protein |
Species Homo sapiens [TaxId:9606] [316254] (5 PDB entries) |
Domain d5f9cb3: 5f9c B:305-421 [316382] Other proteins in same PDB: d5f9ca4, d5f9cb4 automated match to d3pmga3 complexed with gol, mg, so4; mutant |
PDB Entry: 5f9c (more details), 2.5 Å
SCOPe Domain Sequences for d5f9cb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f9cb3 c.84.1.0 (B:305-421) automated matches {Homo sapiens [TaxId: 9606]} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkyg
Timeline for d5f9cb3:
View in 3D Domains from other chains: (mouse over for more information) d5f9ca1, d5f9ca2, d5f9ca3, d5f9ca4 |