Lineage for d5f9ca3 (5f9c A:305-421)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2159229Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2159230Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2159322Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2159323Protein automated matches [254721] (3 species)
    not a true protein
  7. 2159324Species Homo sapiens [TaxId:9606] [316254] (5 PDB entries)
  8. 2159339Domain d5f9ca3: 5f9c A:305-421 [316272]
    Other proteins in same PDB: d5f9ca4, d5f9cb4
    automated match to d3pmga3
    complexed with gol, mg, so4; mutant

Details for d5f9ca3

PDB Entry: 5f9c (more details), 2.5 Å

PDB Description: crystal structure of the g121r mutant of human phosphoglucomutase 1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5f9ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f9ca3 c.84.1.0 (A:305-421) automated matches {Homo sapiens [TaxId: 9606]}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkyg

SCOPe Domain Coordinates for d5f9ca3:

Click to download the PDB-style file with coordinates for d5f9ca3.
(The format of our PDB-style files is described here.)

Timeline for d5f9ca3: