Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [316242] (3 PDB entries) |
Domain d5ihyb_: 5ihy B: [316376] automated match to d3djba1 complexed with ni |
PDB Entry: 5ihy (more details), 2.5 Å
SCOPe Domain Sequences for d5ihyb_:
Sequence, based on SEQRES records: (download)
>d5ihyb_ a.211.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} telkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfivetaalvhdli dvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvvq dadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelaee rhefmlqyirqlekdipgid
>d5ihyb_ a.211.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} telkqadqirtwvqsvldwlhisrvadlavyigekenadlfivetaalvhdlidvklpdt irlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvvqdadrlda igavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlq yirqlekdipgid
Timeline for d5ihyb_: