Lineage for d5ihyb_ (5ihy B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2019338Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2019339Protein automated matches [190983] (9 species)
    not a true protein
  7. 2019346Species Bacillus subtilis [TaxId:1423] [316242] (3 PDB entries)
  8. 2019352Domain d5ihyb_: 5ihy B: [316376]
    automated match to d3djba1
    complexed with ni

Details for d5ihyb_

PDB Entry: 5ihy (more details), 2.5 Å

PDB Description: the crystal structure of bacillus subtilis semet-ypgq
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5ihyb_:

Sequence, based on SEQRES records: (download)

>d5ihyb_ a.211.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
telkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfivetaalvhdli
dvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvvq
dadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelaee
rhefmlqyirqlekdipgid

Sequence, based on observed residues (ATOM records): (download)

>d5ihyb_ a.211.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
telkqadqirtwvqsvldwlhisrvadlavyigekenadlfivetaalvhdlidvklpdt
irlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvvqdadrlda
igavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlq
yirqlekdipgid

SCOPe Domain Coordinates for d5ihyb_:

Click to download the PDB-style file with coordinates for d5ihyb_.
(The format of our PDB-style files is described here.)

Timeline for d5ihyb_: