![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
![]() | Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins) |
![]() | Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
![]() | Species Escherichia coli [TaxId:562] [52428] (1 PDB entry) cofactor is MHTF |
![]() | Domain d1dnpb2: 1dnp B:1-200 [31631] Other proteins in same PDB: d1dnpa1, d1dnpb1 complexed with fad, mhf |
PDB Entry: 1dnp (more details), 2.3 Å
SCOPe Domain Sequences for d1dnpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dnpb2 c.28.1.1 (B:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} tthlvwfrqdlrlhdnlalaaacrnssarvlalyiatprqwathnmsprqaelinaqlng lqialaekgipllfrevddfvasveivkqvcaensvthlfynyqyevnerardveveral rnvvcegfddsvilppgavmtgnhemykvftpfknawlkrlregmpecvaapkvrssgsi epspsitlnyprqsfdtahf
Timeline for d1dnpb2: