![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d5if1d1: 5if1 D:176-309 [316304] Other proteins in same PDB: d5if1a_, d5if1c_ automated match to d1finb1 |
PDB Entry: 5if1 (more details), 2.61 Å
SCOPe Domain Sequences for d5if1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5if1d1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
Timeline for d5if1d1:
![]() Domains from other chains: (mouse over for more information) d5if1a_, d5if1b1, d5if1b2, d5if1c_ |