Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
Domain d5if1b1: 5if1 B:176-309 [316319] Other proteins in same PDB: d5if1a_, d5if1c_ automated match to d1finb1 |
PDB Entry: 5if1 (more details), 2.61 Å
SCOPe Domain Sequences for d5if1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5if1b1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
Timeline for d5if1b1:
View in 3D Domains from other chains: (mouse over for more information) d5if1a_, d5if1c_, d5if1d1, d5if1d2 |