Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.14: MIT domain [116846] (2 families) |
Family a.7.14.0: automated matches [191520] (1 protein) not a true family |
Protein automated matches [190877] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188239] (3 PDB entries) |
Domain d5fvkb_: 5fvk B: [316296] automated match to d4niqa_ |
PDB Entry: 5fvk (more details), 1.66 Å
SCOPe Domain Sequences for d5fvkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fvkb_ a.7.14.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf teylnraeqlkkhleseeanaa
Timeline for d5fvkb_: