SCOPe 2.08: Domain d5fvkb_: 5fvk B:

Lineage for d5fvkb_ (5fvk B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (2 families)

5. Family a.7.14.0: automated matches [191520] (1 protein)
   not a true family

6. Protein automated matches [190877] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188239] (3 PDB entries)

8. Domain d5fvkb_: 5fvk B: [316296]
   automated match to d4niqa_

Details for d5fvkb_

PDB Entry: 5fvk, 1.66 Å

PDB Description: crystal structure of vps4-vfa1 complex from s.cerevisiae at 1.66 a resolution.

PDB Compounds: (B:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d5fvkb_:

Sequence; same for both SEQRES and ATOM records:

>d5fvkb_ a.7.14.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
teylnraeqlkkhleseeanaa

Timeline for d5fvkb_:

• d5fvkb_ first appeared in SCOPe 2.06
  
• d5fvkb_ appears in SCOPe 2.07