Lineage for d5fvka_ (5fvk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696892Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2696909Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 2696910Protein automated matches [190877] (3 species)
    not a true protein
  7. 2696911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188239] (3 PDB entries)
  8. 2696912Domain d5fvka_: 5fvk A: [316314]
    automated match to d4niqa_

Details for d5fvka_

PDB Entry: 5fvk (more details), 1.66 Å

PDB Description: crystal structure of vps4-vfa1 complex from s.cerevisiae at 1.66 a resolution.
PDB Compounds: (A:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d5fvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvka_ a.7.14.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
teylnraeqlkkhleseeanaa

SCOPe Domain Coordinates for d5fvka_:

Click to download the PDB-style file with coordinates for d5fvka_.
(The format of our PDB-style files is described here.)

Timeline for d5fvka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5fvkb_