Lineage for d5c16b2 (5c16 B:220-605)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875702Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins)
    common fold is decorated with additional structures
  6. 2875712Protein automated matches [316214] (1 species)
    not a true protein
  7. 2875713Species Human (Homo sapiens) [TaxId:9606] [316215] (1 PDB entry)
  8. 2875715Domain d5c16b2: 5c16 B:220-605 [316216]
    Other proteins in same PDB: d5c16a1, d5c16b1, d5c16c1, d5c16d1
    automated match to d1zvra2
    complexed with po4

Details for d5c16b2

PDB Entry: 5c16 (more details), 2.07 Å

PDB Description: myotubularin-related proetin 1
PDB Compounds: (B:) Myotubularin-related protein 1

SCOPe Domain Sequences for d5c16b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c16b2 c.45.1.3 (B:220-605) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekfpingwkvydpvseykrqglpneswkiskinsnyefcdtypaiivvptsvkdddlskv
aafrakgrvpvlswihpesqatitrcsqplvgpndkrckedekylqtimdanaqshklii
fdarqnsvadtnktkgggyesesaypnaelvfleihnihvmreslrklkeivypsidear
wlsnvdgthwleyirmllagavriadkiesgktsvvvhssdgwdrtaqltslamlmldsy
yrtikgfetlvekewisfghrfalrvghgndnhadadrspiflqfvdcvwqmtrqfpsaf
efnelflitildhlysclfgtflcnceqqrfkedvytktislwsyinsqldefsnpffvn
yenhvlypvaslshlelwvnyyvrwn

SCOPe Domain Coordinates for d5c16b2:

Click to download the PDB-style file with coordinates for d5c16b2.
(The format of our PDB-style files is described here.)

Timeline for d5c16b2: