Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins) common fold is decorated with additional structures |
Protein automated matches [316214] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [316215] (1 PDB entry) |
Domain d5c16b2: 5c16 B:220-605 [316216] Other proteins in same PDB: d5c16a1, d5c16b1, d5c16c1, d5c16d1 automated match to d1zvra2 complexed with po4 |
PDB Entry: 5c16 (more details), 2.07 Å
SCOPe Domain Sequences for d5c16b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c16b2 c.45.1.3 (B:220-605) automated matches {Homo sapiens [TaxId: 9606]} ekfpingwkvydpvseykrqglpneswkiskinsnyefcdtypaiivvptsvkdddlskv aafrakgrvpvlswihpesqatitrcsqplvgpndkrckedekylqtimdanaqshklii fdarqnsvadtnktkgggyesesaypnaelvfleihnihvmreslrklkeivypsidear wlsnvdgthwleyirmllagavriadkiesgktsvvvhssdgwdrtaqltslamlmldsy yrtikgfetlvekewisfghrfalrvghgndnhadadrspiflqfvdcvwqmtrqfpsaf efnelflitildhlysclfgtflcnceqqrfkedvytktislwsyinsqldefsnpffvn yenhvlypvaslshlelwvnyyvrwn
Timeline for d5c16b2: