![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 proteins) common fold is decorated with additional structures |
![]() | Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102424] (5 PDB entries) |
![]() | Domain d1zvra2: 1zvr A:199-586 [125724] Other proteins in same PDB: d1zvra1 automated match to d1lw3a2 complexed with 3pi, edo |
PDB Entry: 1zvr (more details), 1.98 Å
SCOPe Domain Sequences for d1zvra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvra2 c.45.1.3 (A:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs ysnhvlypvasmrhlelwvgyyirwnpr
Timeline for d1zvra2: