| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.2: PAPS reductase-like [52410] (2 proteins) |
| Protein Phosphoadenylyl sulphate (PAPS) reductase [52411] (1 species) |
| Species Escherichia coli [TaxId:562] [52412] (1 PDB entry) |
| Domain d1sura_: 1sur A: [31620] |
PDB Entry: 1sur (more details), 2 Å
SCOPe Domain Sequences for d1sura_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]}
skldlnalnelpkvdrilalaetnaelekldaegrvawaldnlpgeyvlsssfgiqaavs
lhlvnqirpdipviltdtgylfpetyrfideltdklklnlkvyratesaawqearygklw
eqgvegiekyndinkvepmnralkelnaqtwfaglrreqsgsranlpvlaiqrgvfkvlp
iidwdnrtiyqylqkhglkyhplwdegylsvgdth
Timeline for d1sura_: