Lineage for d1sura_ (1sur A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842388Family c.26.2.2: PAPS reductase-like [52410] (2 proteins)
  6. 1842389Protein Phosphoadenylyl sulphate (PAPS) reductase [52411] (1 species)
  7. 1842390Species Escherichia coli [TaxId:562] [52412] (1 PDB entry)
  8. 1842391Domain d1sura_: 1sur A: [31620]

Details for d1sura_

PDB Entry: 1sur (more details), 2 Å

PDB Description: phospho-adenylyl-sulfate reductase
PDB Compounds: (A:) paps reductase

SCOPe Domain Sequences for d1sura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]}
skldlnalnelpkvdrilalaetnaelekldaegrvawaldnlpgeyvlsssfgiqaavs
lhlvnqirpdipviltdtgylfpetyrfideltdklklnlkvyratesaawqearygklw
eqgvegiekyndinkvepmnralkelnaqtwfaglrreqsgsranlpvlaiqrgvfkvlp
iidwdnrtiyqylqkhglkyhplwdegylsvgdth

SCOPe Domain Coordinates for d1sura_:

Click to download the PDB-style file with coordinates for d1sura_.
(The format of our PDB-style files is described here.)

Timeline for d1sura_: