SCOPe 2.08: Domain d1sura_: 1sur A:

Lineage for d1sura_ (1sur A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.2: PAPS reductase-like [52410] (2 proteins)

6. Protein Phosphoadenylyl sulphate (PAPS) reductase [52411] (1 species)

7. Species Escherichia coli [TaxId:562] [52412] (1 PDB entry)

8. Domain d1sura_: 1sur A: [31620]

Details for d1sura_

PDB Entry: 1sur, 2 Å

PDB Description: phospho-adenylyl-sulfate reductase

PDB Compounds: (A:) paps reductase

SCOPe Domain Sequences for d1sura_:

Sequence; same for both SEQRES and ATOM records:

>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]}
skldlnalnelpkvdrilalaetnaelekldaegrvawaldnlpgeyvlsssfgiqaavs
lhlvnqirpdipviltdtgylfpetyrfideltdklklnlkvyratesaawqearygklw
eqgvegiekyndinkvepmnralkelnaqtwfaglrreqsgsranlpvlaiqrgvfkvlp
iidwdnrtiyqylqkhglkyhplwdegylsvgdth

Timeline for d1sura_:

• d1sura_ first appeared (with stable ids) in SCOP 1.55, called d1sur__
  
• d1sura_ appears in SCOPe 2.07