Lineage for d1sur__ (1sur -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22501Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 22574Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) (S)
  5. 22594Family c.26.2.2: Phosphoadenylyl sulphate (PAPS) reductase [52410] (1 protein)
  6. 22595Protein Phosphoadenylyl sulphate (PAPS) reductase [52411] (1 species)
  7. 22596Species Escherichia coli [TaxId:562] [52412] (1 PDB entry)
  8. 22597Domain d1sur__: 1sur - [31620]

Details for d1sur__

PDB Entry: 1sur (more details), 2 Å

PDB Description: phospho-adenylyl-sulfate reductase

SCOP Domain Sequences for d1sur__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sur__ c.26.2.2 (-) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli}
skldlnalnelpkvdrilalaetnaelekldaegrvawaldnlpgeyvlsssfgiqaavs
lhlvnqirpdipviltdtgylfpetyrfideltdklklnlkvyratesaawqearygklw
eqgvegiekyndinkvepmnralkelnaqtwfaglrreqsgsranlpvlaiqrgvfkvlp
iidwdnrtiyqylqkhglkyhplwdegylsvgdth

SCOP Domain Coordinates for d1sur__:

Click to download the PDB-style file with coordinates for d1sur__.
(The format of our PDB-style files is described here.)

Timeline for d1sur__: