PDB entry 1sur

View 1sur on RCSB PDB site
Description: phospho-adenylyl-sulfate reductase
Class: oxidoreductase
Keywords: assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase
Deposited on 1998-04-01, released 1999-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: paps reductase
    Species: Escherichia coli [TaxId:562]
    Gene: cysH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sura_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1surA (A:)
    skldlnalnelpkvdrilalaetnaelekldaegrvawaldnlpgeyvlsssfgiqaavs
    lhlvnqirpdipviltdtgylfpetyrfideltdklklnlkvyratesaawqearygklw
    eqgvegiekyndinkvepmnralkelnaqtwfaglrreqsgsranlpvlaiqrgvfkvlp
    iidwdnrtiyqylqkhglkyhplwdegylsvgdth