| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein NK cell-activating receptor nkg2d [64453] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64455] (4 PDB entries) |
| Domain d4s0ub_: 4s0u B: [316136] Other proteins in same PDB: d4s0uc_ automated match to d1mpua_ |
PDB Entry: 4s0u (more details), 2.35 Å
SCOPe Domain Sequences for d4s0ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s0ub_ d.169.1.1 (B:) NK cell-activating receptor nkg2d {Human (Homo sapiens) [TaxId: 9606]}
pltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklv
ksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpnty
icmqrt
Timeline for d4s0ub_: