SCOPe 2.06: Domain d4yysa_: 4yys A:

Lineage for d4yysa_ (4yys A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (11 species)
   not a true protein

7. Species Ficus carica [TaxId:3494] [315519] (1 PDB entry)

8. Domain d4yysa_: 4yys A: [315520]
   automated match to d1cqda_
   complexed with po4

Details for d4yysa_

PDB Entry: 4yys, 1.35 Å

PDB Description: ficin b crystal form ii

PDB Compounds: (A:) Ficin isoform B

SCOPe Domain Sequences for d4yysa_:

Sequence; same for both SEQRES and ATOM records:

>d4yysa_ d.3.1.1 (A:) automated matches {Ficus carica [TaxId: 3494]}
lpetvdwriqgavnpirnqgrcgscwafsvvvvvegitkivtdelpslseqqlvdcatsy
knlgcsggwmtkaydyiiknggitsqsnypytarkgecnkdlasqivatidsyehvprnn
enalknavanqpvsvtieaggrafelyksgvfvgscgtkldhavvaigygsendvdywlv
rnswgtnwgergyiklqrnvaeptgkcgiamqstypvkkt

Timeline for d4yysa_:

• d4yysa_ is new in SCOPe 2.06-stable
  
• d4yysa_ appears in SCOPe 2.07
  
• d4yysa_ appears in the current release, SCOPe 2.08