Lineage for d1qfjc2 (1qfj C:98-232)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984627Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 984628Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 984629Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 984699Protein NAD(P)H:flavin oxidoreductase [52353] (1 species)
  7. 984700Species Escherichia coli [TaxId:562] [52354] (1 PDB entry)
  8. 984703Domain d1qfjc2: 1qfj C:98-232 [31547]
    Other proteins in same PDB: d1qfja1, d1qfjb1, d1qfjc1, d1qfjd1
    CASP3
    complexed with gol

Details for d1qfjc2

PDB Entry: 1qfj (more details), 2.2 Å

PDB Description: crystal structure of nad(p)h:flavin oxidoreductase from escherichia coli
PDB Compounds: (C:) protein (flavin reductase)

SCOPe Domain Sequences for d1qfjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfjc2 c.25.1.1 (C:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
rddeerpmiliaggtgfsyarsilltalarnpnrditiywggreeqhlydlcelealslk
hpglqvvpvveqpeagwrgrtgtvltavlqdhgtlaehdiyiagrfemakiardlfcser
naredrlfgdafafi

SCOPe Domain Coordinates for d1qfjc2:

Click to download the PDB-style file with coordinates for d1qfjc2.
(The format of our PDB-style files is described here.)

Timeline for d1qfjc2: