![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (5 proteins) |
![]() | Protein NAD(P)H:flavin oxidoreductase [52353] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52354] (1 PDB entry) |
![]() | Domain d1qfjc2: 1qfj C:98-232 [31547] Other proteins in same PDB: d1qfja1, d1qfjb1, d1qfjc1, d1qfjd1 CASP3 complexed with gol |
PDB Entry: 1qfj (more details), 2.2 Å
SCOPe Domain Sequences for d1qfjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfjc2 c.25.1.1 (C:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} rddeerpmiliaggtgfsyarsilltalarnpnrditiywggreeqhlydlcelealslk hpglqvvpvveqpeagwrgrtgtvltavlqdhgtlaehdiyiagrfemakiardlfcser naredrlfgdafafi
Timeline for d1qfjc2: