Lineage for d5g0rd2 (5g0r D:270-549)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004845Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2004846Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2004847Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2004908Protein automated matches [315354] (2 species)
    not a true protein
  7. 2004909Species Methanothermobacter marburgensis [TaxId:145263] [315355] (2 PDB entries)
  8. 2004916Domain d5g0rd2: 5g0r D:270-549 [315456]
    Other proteins in same PDB: d5g0ra1, d5g0rb1, d5g0rc_, d5g0rd1, d5g0re1, d5g0rf_
    automated match to d1hbna1
    complexed with cl, f43, k, mg, na, tp7

Details for d5g0rd2

PDB Entry: 5g0r (more details), 1.25 Å

PDB Description: methyl-coenzyme m reductase i from methanothermobacter marburgensis exposed to 3-nitrooxypropanol
PDB Compounds: (D:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d5g0rd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g0rd2 a.89.1.1 (D:270-549) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
xqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d5g0rd2:

Click to download the PDB-style file with coordinates for d5g0rd2.
(The format of our PDB-style files is described here.)

Timeline for d5g0rd2: