Lineage for d5g0rb1 (5g0r B:2-188)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197885Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2197936Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2197997Protein automated matches [315351] (2 species)
    not a true protein
  7. 2197998Species Methanothermobacter marburgensis [TaxId:145263] [315352] (2 PDB entries)
  8. 2198004Domain d5g0rb1: 5g0r B:2-188 [315365]
    Other proteins in same PDB: d5g0ra2, d5g0rb2, d5g0rc_, d5g0rd2, d5g0re2, d5g0rf_
    automated match to d1hbnb2
    complexed with cl, f43, k, mg, na, tp7

Details for d5g0rb1

PDB Entry: 5g0r (more details), 1.25 Å

PDB Description: methyl-coenzyme m reductase i from methanothermobacter marburgensis exposed to 3-nitrooxypropanol
PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d5g0rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g0rb1 d.58.31.2 (B:2-188) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d5g0rb1:

Click to download the PDB-style file with coordinates for d5g0rb1.
(The format of our PDB-style files is described here.)

Timeline for d5g0rb1: