Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83331] [315286] (2 PDB entries) |
Domain d5e0sa_: 5e0s A: [315301] automated match to d1y7oc_ |
PDB Entry: 5e0s (more details), 2.9 Å
SCOPe Domain Sequences for d5e0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e0sa_ c.14.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]} yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee akdygiidtvleyrkls
Timeline for d5e0sa_: