PDB entry 5e0s

View 5e0s on RCSB PDB site
Description: crystal structure of the active form of the proteolytic complex clpP1 and clpP2
Class: hydrolase
Keywords: Hydrolase
Deposited on 2015-09-29, released 2016-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0se_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sg_
  • Chain 'H':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sh_
  • Chain 'I':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0si_
  • Chain 'J':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sj_
  • Chain 'K':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sk_
  • Chain 'L':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sl_
  • Chain 'M':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sm_
  • Chain 'N':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0sn_
  • Chain 'a':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: ATP-dependent Clp protease proteolytic subunit 2
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP2, MT2535
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: ATP-dependent clp protease proteolytic subunit 1
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: clpP1, clpP, MT2536
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e0sA (A:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sA (A:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrkls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e0sB (B:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sB (B:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrklsaqta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e0sC (C:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sC (C:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrkls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e0sD (D:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sD (D:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrkls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5e0sE (E:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sE (E:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrklsaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5e0sF (F:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sF (F:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrkls
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5e0sG (G:)
    mnsqnsqiqpqaryilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaql
    lvlesldpdrditmyinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagt
    pgkrmalpnarvlihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvir
    kdtdrdkiltaeeakdygiidtvleyrklsaqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sG (G:)
    yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
    myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
    ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
    akdygiidtvleyrkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5e0sH (H:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sH (H:)
    mrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyins
    pggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpl
    ggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfv
    dhiitr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5e0sI (I:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sI (I:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
    diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5e0sJ (J:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sJ (J:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
    diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5e0sK (K:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sK (K:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
    diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5e0sL (L:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sL (L:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
    diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5e0sM (M:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sM (M:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
    diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5e0sN (N:)
    msqvtdmrsnsqglsltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdi
    slyinspggsisagmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalphari
    lmhqplggvtgsaadiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaea
    leygfvdhiitrahvngeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0sN (N:)
    sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
    maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
    diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah
    vnge
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.